Thymosin Beta-4 (aka TB-500) 10mg vials lyophilized powder
Thymosin Beta-4 (aka TB-500) is a code for a synthesized protein TMSB4X that is encoded in the human gene code. This protein is made up of 43 amino acids that help to encode actin sequestering proteins that play a role in cell differentiation, proliferation and migration.
Research Indications: Anti-Aging Research
11 Item Items
In Stock
Warning: Last items in stock!
Availability date:
TB-500 (Thymosin Beta 4)
Thymosin Beta-4 (aka TB-500) 10mg vials lyophilized powder
Thymosin Beta-4 (aka TB-500) is a code for a synthesized protein TMSB4X that is encoded in the human gene code. This protein is made up of 43 amino acids that help to encode actin sequestering proteins that play a role in cell differentiation, proliferation and migration.
Research Indications: Anti-Aging Research
Recipient :
* Required fields
or Cancel
Thymosin Beta-4 (aka TB-500) 10mg vials lyophilized powder
Thymosin Beta-4 (active section TB-500) is a code for a synthesized protein TMSB4X that is encoded in the human gene code. This protein is made up of 43 amino acids that help to encode actin sequestering proteins that play a role in cell differentiation, proliferation and migration.
TB-500 closely matches a short section of thymosin beta-4 that appears to be the active section. As such, this short section creates a truncated peptide that has been found to provide at least most of the benefits of the complete thymosin beta-4 molecule, and is more readily manufactured. For healing injuries TB-500 may be just as effective as thymosin beta-4.
Thymosin Beta 4 (TB500) is cited in significant research results in the healing of many different types of tissues in many types of animal test subjects. Thymosin Beta-4 fosters wound repair of various tissues.
Research Indications: Anti-Aging Research
Thymosin Beta 4
CAS number: 77591-33-4
Molecular formula: C212H350N56O78S
Molecular Mass: 4963.4408
Sequence: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (Modifications: Ser-1 = N-terminal Ac)
Thymosin Beta 4 Naturally occuring, potent regulator of actin polymerization present in human platelets at a concentration of 200 - 500 μM. Sequesters G-actin monomers in a 1:1 ratio (Kd = 0.7 - 1.0 μM) and allows rapid filament polymerization in the presence of profilin. Implicated in wound healing, induction of MMPs, chemotaxis, angiogenesis, inflammatory processes and tumor progression.
USAGE: For Research Use Only! Not For Use in Humans.